pCL- Eco Plasmid
PVT2203 2ug
pCL- Eco Plasmid Information
Promoter: CMV
Replicator: pUC ori, SV40 ori
Terminator: SV40 poly (A) signal
Plasmid classification: virus series, retrovirus packaging vector map
Plasmid size: 12341bp
Plasmid label: gag-pol
Prokaryotic resistance: Amp
Cloned strain: Stbl3
Culture conditions: 37 ℃, aerobic LB
Expression host: mammalian cells
Induction mode: no induction, instantaneous expression
5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG
3'sequencing primers: primers designed according to sequence
pCL- Eco Plasmid Description
pCL- Eco Plasmid packaging vector is a part of the RetroMax expression system and has been designed to maximize recombinant-retrovirus titers in a simple, efficient, and flexible experimental system. By introducing a retroviral vector into a cell expressing retroviral proteins, retroviral particles (virions) are shed into the culture medium at the rate of about 1 infectious particle/cell/day. Retrovirus tropism is determined at 3 levels. The first is simply a function of viral envelope protein, gp70. The envelope determines which cells the virus will enter. gp70 comes in three different flavors for gene therapy. Retroviruses obtained by cotransfection with pCL-Eco vector will infect mouse and rat cells, but not human cells.
pCL- Eco Plasmid Sequence
LOCUS Exported 12341 bp ds-DNA circular SYN 06-SEP-2016
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS Untitled 10
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12341)
AUTHORS .
TITLE Direct Submission
JOURNAL Exported Tuesday, September 6, 2016 from SnapGene Viewer 3.1.4
FEATURES Location/Qualifiers
source 1..12341
/organism="synthetic DNA construct"
/mol_type="other DNA"
rep_origin 283..871
/direction=RIGHT
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
rep_origin 1107..1241
/note="SV40 ori"
/note="SV40 origin of replication"
polyA_signal 1699..1833
/note="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
CDS complement(2105..2125)
/codon_start=1
/product="nuclear localization signal of SV40 large T
antigen"
/note="SV40 NLS"
/translation="PKKKRKV"
intron 2255..2320
/note="small t intron"
/note="simian virus 40 (SV40) small t antigen intron"
misc_feature 5033..5407
/note="pol region"
/note="Moloney murine leukemia virus (MMLV) pol region
containing the splice acceptor site"
CDS complement(9767..10183)
/note="gag (truncated)"
/note="truncated Moloney murine leukemia virus (MMLV) gag
gene lacking the start codon"
promoter complement(10495..10698)
/note="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
enhancer 10699..11078
/note="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 11488..11592
/gene="bla"
/note="AmpR promoter"
CDS 11593..112
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/note="AmpR"
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
ORIGIN
1 tggtaagccc tcccgtatcg tagttatcta cacgacgggg agtcaggcaa ctatggatga
61 acgaaataga cagatcgctg agataggtgc ctcactgatt aagcattggt aactgtcaga
121 ccaagtttac tcatatatac tttagattga tttaaaactt catttttaat ttaaaaggat
181 ctaggtgaag atcctttttg ataatctcat gaccaaaatc ccttaacgtg agttttcgtt
241 ccactgagcg tcagaccccg tagaaaagat caaaggatct tcttgagatc ctttttttct
301 gcgcgtaatc tgctgcttgc aaacaaaaaa accaccgcta ccagcggtgg tttgtttgcc
361 ggatcaagag ctaccaactc tttttccgaa ggtaactggc ttcagcagag cgcagatacc
421 aaatactgtc cttctagtgt agccgtagtt aggccaccac ttcaagaact ctgtagcacc
481 gcctacatac ctcgctctgc taatcctgtt accagtggct gctgccagtg gcgataagtc
541 gtgtcttacc gggttggact caagacgata gttaccggat aaggcgcagc ggtcgggctg
601 aacggggggt tcgtgcacac agcccagctt ggagcgaacg acctacaccg aactgagata
661 cctacagcgt gagctatgag aaagcgccac gcttcccgaa gggagaaagg cggacaggta
721 tccggtaagc ggcagggtcg gaacaggaga gcgcacgagg gagcttccag ggggaaacgc
781 ctggtatctt tatagtcctg tcgggtttcg ccacctctga cttgagcgtc gatttttgtg
841 atgctcgtca ggggggcgga gcctatggaa aaacgccagc aacgcggcct ttttacggtt
901 cctggccttt tgctggcctt ttgctcacat gttctttcct gcgttatccc ctgattctgt
961 ggataaccgt attaccgcct ttgagtgagc tgataccgct cgccgcagcc gaacgaccga
1021 gcgcagcgag tcagtgagcg aggaagcgga agagcgccca atacgcaaac cgcctctccc
1081 cgcgcgttgg ccgattcatt aatgcagcct ccaaaaaagc ctcctcacta cttctggaat
1141 agctcagagg ccgaggcggc ctcggcctct gcataaataa aaaaaattag tcagccatgg
1201 ggcggagaat gggcggaact gggcggagtt aggggcggga tgggcggagt aagacccgca
1261 cccgttccca aactgcttat taaagggggt atggaggtgc tggaccttgt gacagggcca
1321 gacagtgtga cagaaataga agcagtcctg ttttgacaag ttgcctctgg aagcctctac
1381 aatgcctctc ttctttttct ccagagtaag cggaggccag gggcccccgg cctctgctta
1441 atactaaaaa aaacagctgt tgtcatagta atgattgggt ggaaacattc taggcctggg
1501 tggagaggct ttttgcttcc tcttgcaaaa ccacactgcc ctctggaggg cagttgccta
1561 gcaactaatt aaaagaggat gtcgcacggc cagctgcggt cagttagtca cttcctgctt
1621 aactgacttg acattttcta ttttaagagt cgggaggaaa attactgtgt tggaggccct
1681 ccgccatctt ctgaagctga tccagacatg ataagataca ttgatgagtt tggacaaacc
1741 acaactagaa tgcagtgaaa aaaatgcttt atttgtgaaa tttgtgatgc tattgcttta
1801 tttgtaacca ttataagctg caataaacaa gttaacaaca acaattgcat tcattttatg
1861 tttcaggttc agggggaggt gtgggaggtt ttttaaagca agtaaaacct ctacaaatgt
1921 ggtatggctg attatgatct ctagtcaagg cactatacat caaatatttt tccataattt
1981 tcttgtatag cagtgcagct ttttcctttg tggtgtaaat agcaaagcaa gcaagagttc
2041 tattactaaa cacagcatga ctcaaaaaac ttagcaattc tgaaggaaag tccttggggt
2101 cttctacctt tctcttcttt tttggaggag tagaatgttg agagtcagca gtagcctcat
2161 catcactaga tggcatttct tctgagcaaa acaggttttc ctcattaaag gcattccacc</
.....
//
Caution:
1. This product is FOR RESEARCH USE ONLY!
2. The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.
Search name
pCL-Eco,pCL-Eco Plasmid pCL-Eco,pCL-Eco vector