pQE-52

Search name

pQE-52,Plasmid pQE-52,pQE-52 vector

pQE-52 Multiple cloning site

pQE-52 Sequence

LOCUS       Exported                3436 bp ds-DNA     circular SYN 05-DEC-2013
DEFINITION  Bacterial vector for expressing untagged proteins. For other reading
            frames, use pQE-50 or pQE-51.
ACCESSION   .
VERSION     .
KEYWORDS    pQE-52
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3436)
  AUTHORS   Qiagen
  TITLE     Direct Submission
  JOURNAL   Exported Wednesday, September 14, 2016 from SnapGene Viewer 3.1.4
COMMENT     Discontinued pQE vector.
FEATURES             Location/Qualifiers
     source          1..3436
                     /organism="synthetic DNA construct"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
     promoter        10..54
                     /note="T5 promoter"
                     /note="bacteriophage T5 promoter for E. coli RNA
                     polymerase, with embedded lac operator"
     protein_bind    30..46
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     protein_bind    62..78
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     RBS             101..106
                     /note="ribosome binding site"
     CDS             115..117
                     /codon_start=1
                     /product="start codon"
                     /note="ATG"
                     /translation="M"
     misc_feature    119..166
                     /note="MCS"
                     /note="multiple cloning site"
     misc_feature    166..176
                     /note="stop codons"
                     /note="stop codons in all three reading frames"
     terminator      182..276
                     /note="lambda t0 terminator"
                     /note="transcription terminator from phage lambda"
     CDS             320..979
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     terminator      1044..1130
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(1612..2200)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(2371..3231)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQAAMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(3232..3336)
                     /gene="bla"
                     /note="AmpR promoter"
ORIGIN
        1 ctcgagaaat cataaaaaat ttatttgctt tgtgagcgga taacaattat aatagattca
       61 attgtgagcg gataacaatt tcacacagaa ttcattaaag aggagaaatt aactatgagg
      121 atccgcatgc gagctcggta ccccgggtcg acctgcagcc aagcttaatt agctgagctt
      181 ggactcctgt tgatagatcc agtaatgacc tcagaactcc atctggattt gttcagaacg
      241 ctcggttgcc gccgggcgtt ttttattggt gagaatccaa gctagcttgg cgagattttc
      301 aggagctaag gaagctaaaa tggagaaaaa aatcactgga tataccaccg ttgatatatc
      361 ccaatggcat cgtaaagaac attttgaggc atttcagtca gttgctcaat gtacctataa
      421 ccagaccgtt cagctggata ttacggcctt tttaaagacc gtaaagaaaa ataagcacaa
      481 gttttatccg gcctttattc acattcttgc ccgcctgatg aatgctcatc cggaatttcg
      541 tatggcaatg aaagacggtg agctggtgat atgggatagt gttcaccctt gttacaccgt
      601 tttccatgag caaactgaaa cgttttcatc gctctggagt gaataccacg acgatttccg
      661 gcagtttcta cacatatatt cgcaagatgt ggcgtgttac ggtgaaaacc tggcctattt
      721 ccctaaaggg tttattgaga atatgttttt cgtctcagcc aatccctggg tgagtttcac
      781 cagttttgat ttaaacgtgg ccaatatgga caacttcttc gcccccgttt tcaccatggg
      841 caaatattat acgcaaggcg acaaggtgct gatgccgctg gcgattcagg ttcatcatgc
      901 cgtctgtgat ggcttccatg tcggcagaat gcttaatgaa ttacaacagt actgcgatga
      961 gtggcagggc ggggcgtaat ttttttaagg cagttattgg tgcccttaaa cgcctggggt
     1021 aatgactctc tagcttgagg catcaaataa aacgaaaggc tcagtcgaaa gactgggcct
     1081 ttcgttttat ctgttgtttg tcggtgaacg ctctcctgag taggacaaat ccgccgctct