pRI101-AN
Catalog No. PVT11185
Packing 2ug
pRI101-AN Information
Function plant expression plasmid
Promoter: 35S
Prokaryotic resistance: kanamycin Kan
Screening markers: Neo/G418
Competent cells: Stbl3
Culture conditions: 37 degrees centigrade
pRI101-AN Description
PRI101-AN is a vector expressing foreign genes in dicotyledonous plant cells. Use of Agrobacterium tumefaciens.
pRI101 DNA vectors are binary plant transformation vectors intended for foreign gene expression in plant cells. These agrobacterium-mediated plant transformation vectors carry the 35S promoter of caμliflower mosaic virus (CaMV) and the 5’ non-coding region (5’-UTR) of the alcohol dehydrogenase (ADH) gene. The 5’-UTR of ADH functions as a translation enhancer in plants. There are two types of pRI101 DNA vectors, the pRI101-AN DNA vector, which carries the 5’-UTR of Arabidopsis ADH (AtADH 5’-UTR), and the pRI101 ON DNA vector, which carries the 5’-UTR of rice ADH (OsADH 5’-UTR). The pRI101-AN DNA vector is for dicotyledonous plants such as tobacco or Arabidopsis while the pRI101-ON DNA vector is for monocotyledonous plants such as rice.Although the pRI101 DNA vectors are shuttle vectors and replicate autonomously in E. coli and Rhizobium (Agrobacterium), they are high copy number plasmids because they contain the same replication origin as pUC-type plasmids (ColE1 ori). These vectors are also stably maintained in Rhizobium (Agrobacterium) containing the mutant-type replication origin Ri (Ri-ori). The pRI101 DNA vectors are capable of stably integrating target genes into plant chromosomes because the vector cloning sites are located closer to the Right Border (RB) of T-DNA than the selection marker (NPT II) of the plant, so the target gene is not deleted.
pRI101-AN Sequence
LOCUS Exported 10417 bp ds-DNA circular SYN 23-NOV-2017
DEFINITION synthetic circular DNA
FEATURES Location/Qualifiers
source 1..10417
/organism="synthetic DNA construct"
/mol_type="other DNA"
rep_origin complement(57..645)
/direction=LEFT
/label=ori
/note="high-copy-number colE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(6419..7213)
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/label=NeoR/KanR
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin)"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
promoter 7620..7650
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 7658..7674
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 7682..7698
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(9017..9033)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
ORIGIN
1 tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc
61 cataggctcc gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga
121 aacccgacag gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct
181 cctgttccga ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg
241 gcgctttctc atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag
301 ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat
361 cgtcttgagt ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac
421 aggattagca gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac
481 tacggctaca ctagaagaac agtatttggt atctgcgctc tgctgaagcc agttaccttc
541 ggaaaaagag ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt
601 tttgtttgca agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc
661 ttttctacgg ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg
721 agattatcaa aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca
781 atctaaagta tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca
841 cctatctcag cgatctgtct atttcgttca tccatagttg cctgactcga tcctacaagg
901 tagaatccgc ctgagtcgca agggtgactt cgcctatatt ggacgacggc gcgcagaggg
961 cgacctcttt ttgggttacg attgtaggat tatcactaaa acaatacatg aacatattca
1021 aatggcaatc tctctaaggc attggaaata aatacaaata acagttgggt ggagtttttc
1081 gacctgaggg cgttaacctt ctgttaacct aaaagctctt gcccaaacag cagaatcggc
1141 gctaattgcc agcggcggaa cttttccagt ttcgcgaaaa atatcgccac tggcaaggaa
1201 tgggtttgag atggcgaagt ctgtcctaaa agcagcgcct gtagttgtag ggttgacggc
1261 cttgatggag cgtcatgccg atgccctctc gagccaactt caagcacatc atcttaaggt
1321 tttcccgccg cattccgaga agggtattcg aacattcggg ccatcggagg cgtccaagct
1381 gctcggcgtt ggcgagtcat atttacggca gaccgcgtct gagatgccag agttgaatgt
1441 tagcatgagc ccaggtggca ggcgaatgtt ctcaattgaa gatatccatg tgattcggaa
1501 gtatatggat caggtcggcc gcgggaaccg gcgctacctg ccacatcgtc gaggcggcga
1561 gcagcttcag gttatctctg tgatgaattt caaaggtggg tcgggtaaga ccaccaccgc
1621 cgcgcatctg gcgcagtacc tcgctatgcg cggatatcga gtcttggcca ttgatctcga
1681 tcctcaagcg agcctttctg cactctttgg gagccaaccg gagacggacg ttggcccgaa
1741 cgaaacgctc tacggcgcta taaggtatga tgatgagcag gtggcaatcg aacgagtcgt
1801 ccgagggact tacattcccg acctccacct gattcctggt aaccttgagc tgatggagtt
1861 tgaacacgat acgccacgcg cgctgatgaa ccgcaaagag ggcgacacgc tcttttatgg
1921 tcgcatcagc caagtaattg aagatatcgc ggataactat gacgtcgtgg tcatcgactg
1981 ccctccccag cttgggtatc tcacgctatc cgcattgact gcggcgacgt ccattcttgt
2041 cacggtccat ccgcagatgc tggatgtgat gtcgatgaac cagtttctgg caatgacatc
2101 gaaccttttg cgtgaaatcg agaatgctgg cgccaagttc aagtttaatt ggatgcgcta
2161 tctgataacc cgtttcgaac cgagcgacgg accacagaac caaatggtag gttatctgcg
2221 gtcgattttt ggcgaaaatg tcctcaattt tccgatgctt aaaaccaccg cggtttcgga
2281 cgctggcctg acaaaccaga ctctattcga agtggagcgt ggcctgttca cgcgctcgac
2341 ctatgatcga gccttggagg cgatgaacgc cgtcaacgac gagatcgaaa cactgatcaa
2401 aaaagcatgg ggtaggccca catgagccgg aagcacatcc ttggcgtctc aactgacgcc
2461 cctgagacgt cgcccgccga caataggacg gcaaagaacc gctccatgcc gctcctcggc
2521 gtaacaagga aggagcgcga tccggcaacg aagctcacag cgaacattgg taacgcactg
2581 cgagagcaaa acgatcgtct tagccgtgcc gaagagatcg agcggcgtct cgctgaaggt
2641 caggcagtga tagagttgga tgcctcgtca atagaaccgt ctttcgtgca ggatcgtatg
2701 cgaggggaca ttgacgggct ccttacttcg atccgggaac aaggacagca agtcccaatc
2761 cttgtgcgac cgcatccgag ccagccgggc cgatatcagg ttgccttcgg ccaccgccgg
2821 ctacgcgccg tttcagaact cggacttccg gtcagggcgg tcgttcgcga actgacggac
2881 gagcaagtgg tcgtagcaca gggtcaggaa aacaatgtgc gcgaagatct taccttcatc
2941 gaaaaggcgc gcttcgcaca tcgcctgaac aggcagtttt ctcgagagat tgtcatcgcc
3001 gcgatgtcga tcgacaagag caatttgtcc aagatgcttc tgctcgttga cgccctcccc
3061 tctgaactga ccgatgctat tggtgccgct cctggtgttg gacggccgag ttggcaacaa
3121 cttgccgagc tgattgagaa agtttcttca ccggccgacg tggctaaata tgctatgtcg
3181 gaggaagttc aagcgctgcc atcggcagaa cgattcaagg cggtgatcgc tagtctgaag
3241 cccagtcggg ttgcgcgtgg acttcccgag gtcatggcca ccccagacgg caccagaatt
3301 gcacaggtga cgcagagcaa ggccaaactg gaaatcacga ttgacaggaa ggcgacgccc
3361 gattttgcga ccttcgtgct cgatcatgtg ccagcgctgt atcaagcgta ccacgctgag
3421 aaccaacgga aacggggaga gtaaaccgca aaagaaaaga gccccctcaa cgtcgccgtc
3481 gcggaagccc ttctgtctct ctagcgcgaa cagaatcgca tttcctcgaa tcctcgtcaa
3541 gagtttttag cgccgttttg gtgagctgat ttcctttgcc tgctgaaagg tgaaagatga
.....
//
Caution:
1. This product is FOR RESEARCH USE ONLY!
2. The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.Take 2ul plasmid into 100 μ L corresponding competent cell, centrifugal then full coating on plate.
3. Shipping temperature is 2-8℃.